Franz Kirmann is an intriguing new addition to the FWD.DJ roster. With a nearly 20 year span in electronic music, he's created lauded TV and film scores(including work with Tom Hodge) and releases avant-garde albums on Denovali Records, Bytes / Ransom Note, Club AC30, Lona Records and his own Days Of Being Wild records that he created in 2009. His exclusive mix is something truly refreshing, merging hyper moody downtempo and ambient with intermittent sparkles of trippy funk.

Tracklist: https://www.fwd.dj/mix/fwd152-franz-kirmann/

FWD152

FWD152 - Franz Kirmann

Jake keeps it a bit hyper and dynamic. lots of vinyl and CD and exactly one half of an mp3. HOUSE NATION Saturdays 2200 AEDT on Radio Northern Beaches 88.7 90.3FM RNB.ORG.AU hosted by Jake Innes (DJ Innes)Cutting-edge music of the now and yesteryear. go to https://culttrax.com to shop our releases.

House Nation

House Nation - Oct 02, 2021 RADIO NORTHERN BEACHES 88.7 90.3fm RNB.ORG.AU

Jon Hopkins - Wintergreen
Olafur Arnalds - Saudade (When We Are Born)
Grouper - Pale Interior
Kings Of Convenience - Love Is A Lonely Thing
HTRK - Kiss Kiss and Rhinestones
Noah Yorke - Trying Too Hard (Lullaby)
F.S. Blumm & Nils Frahm - Desert Mule
Carmen Villain feat. Arve Henriksen - Gestures
Ishmael Ensemble - Visions Of Light
Low Roar - Fucked Up
The National - Nobody Else Will Be There
Morcheeba - Killed Our Love
Radiohead - If You Say the Word
Martina Topley-Bird - Hunt
Tropic of Cancer - Stop Suffering
Herbert feat. Allie Armstrong - The Horror
Andy Stott - Hard to Tell
Imaginary Softwoods - The Imminent Collapse Department

compiled by Gilles Wasserman 
February 2022 in Brooklyn

The Morning After #24

sleepless in sydney 😴

Our twenty seventh episode is a very special one. A gorgeous collaboration with the gorgeous @marcuswhaleinlandsea & @freewificore from FBI 94.5’s Sleepless in Sydney. The two tastemakers have chosen 5 songs each that remind one of the other, how sweet! Including hits from Deftones, HTRK, Coil, Normani, Arca & more

Boy Days Radio - 0027 Sleepless in Sydney

Hashtag & têtes de bois#85

Cnsm毕业证, Boulevarddepoкогдамненадо, Bicenten, Achievements  , Atx, Avides, Addictologie, Classicrockcollection, Chloéthevenin, Getway, Albertabeef, Forthcoming - Illegal Alien, Alcimar Damiani De Brida, Consommation Responsable, Amateurcricket, Bobthebuilder, Anuel Aa Type Beat, Ad Campaing, Akaimpd218, Campo Grande, Amr_Diab, Dirtydoering, Bensalem Baptist Church, Bruno Torres, Ambientpop, Devises, Big Plans ;), Aijaz Aslam, Backgroundclip,  4west, Aa Language, Am720 Kdwn, @Djkurel2, Brent Faiyaz, Alan Vega, Beach Mix, Coming, Edetcannabomaniac

وباريس music 🎲!FREE DOWNLOAD!🎲

Perscriptiondrugpricing, Red Deer, Quranverse, Ressaca, Raefrances, Royaltyfreecinematicmusic, Şıra Telaşı, Religions,, S’Exhibe, The More You Grow, Powers Combined , Professionnels, Relaxing Beats, Pray For Ukraine, Popular,Future, Sávio, Shogun, Tiakola,, Speakers,, Roam, Some Chemistry, Scope Dj, Pill, Undergtound, Sold, Süßmann, Vom, Postmolne, Podcast,Yoga,  Shubh, Results,, Summer Beat Instrumental, Qrush, Veskgreen, Pyrex Type Beat, Talent , Seid,, Plfncpodcast

Absolut Groovers background clip 🐉FREE DOWNLOAD

Gadafi, Georgian-Born, Glimpse Of Us By Joji, Groceries,, Jalraj, Geluidssyteem , Gwaragwara, Friends Committee On National Legislation, Fruitygang, Gangsterrap, Godde$$, Habiller, Generale, Hadakanoyuusha, Gard, Gdtba, Musica Alternativa, Graza, Hugh Waldock, Jex Opolis, Handmadejewellry, Howtoraiseperfectlyimperfectkidsandbeokwithit, Karem, Kingpin Skinny Pimp, Inhliziyo, King Complex, Iamfamira, Hp  Shawty, Magia Record Ost,  Njproducer, Grammaton Recordings, Michael Buble, Laafelosse, Future Today Institute, Geek Dj Set, Ghettofunk, Gabe Pent, Hardcorehiphop,

نجوى copyright free background music 🎰FREE DOWNLOAD

Epiphonelespaul, Frontlineworkers, First Class, Hopefulprofissional, Muthaf Ka, Greenfingaz, Fainal, Ecclesiastes,, Ilymom, Dukilia,, Hispanic Heritage Month, Funk Dançante, Doğuakdeniz, Eyehouse, Fausse, Documentary Feature, Interfaces, Elektrolyrik, Pablo Splice, Dolemite, Djkleo, Fludd,Type, Dj Angelo, Duckin, Kenstewart, Ghost Rare, Free Tpye Beat, Educaciónprimaria, Healing Music For Anxiety,  Free Sad Rap Beat, Faceboo, Frèreshospitaliers, Florida Alternative Rock, Japan Deep House, Endingsong, Domaines, Karol,Monastery,Ryan, Giuseppe Ottaviani

衣川里佳 background sleep music FREE DOWNLOAD

Originally Aired 27/10/2022

Tonight we continue on with the vibe of last weeks show by further exploring some lovely dream pop, indie, ambient, idm & experimental sonic explorations. Venturing to the shores of the USA, Aus, the British Isles and the islands of Japan. Jumping about the years 1979 to 2021. Should be a nice and relaxing journey. Good to have ya along for the ride.

Track Names:
- (Intro Song) Do Your Thing by The Clean
- Rockin’ Back Inside My Heart by Julee Cruise
- Kiss Kiss and Rhinestones by HTRK
- Listen The Snow Is Falling by Mess Esque
- My Gull by Wilson Tanner
- Amo Bishop Roden by Boards Of Canada
- Nine by Autechre
- Saku by Susuma Yokota 
- Umi No Ue Kara by Yasuaki Shimizu
- Three Against Four by Essendon Airport 

Photo: Susumu Yokota, Sakura, Album Cover (1999).

Program Page:

3mdr.allclassweb.com/do-your-thing

Do Your Thing 3MDR 97.1 FM or www.3mdr.com Thurs 9pm to 10pm (AEST)

Show 137 - Dream Pop, Indie, Ambient - Do Your Thing 3MDR 97.1FM or 3mdr.com 27/10/2022

HTKR - Valentina (Night Road HCM REWORK)
included in “Under/Moon” by H C-(M) & Fri(t)zlaser
https://www.mixcloud.com/fdisfunction/undermoon-by-hcmnet/

Valentina written and produced by Jonnine Standish and Nigel Yang.
Available in "Rhinestones"
https://htrk.bandcamp.com/album/rhinestones

HTRK - Valentina (Night Road HCM REWORK) from UNDER/MOON Mixtape

Some of my favorite Post Punk Affiliated music from recent years. Volume 29. This installment features only bands fronted by women.

You can check out the other incarnations of these playlists by checking out these links:

Spotify: goo.gl/XA7g6W
YouTube: goo.gl/xxLwgN
8Tracks: goo.gl/7XBc6b
LastFM: goo.gl/qjseiy

Photo and inspiration by @rachel-escoto

Tropic Of Cancer - A Color
White Hex - Ice Cold
Savages - Flying To Berlin
Lebanon Hanover - Die World
Blouse - Into Black
Chastity Belt - Seattle Party
Sally Dige - Forget Me
Anika - Officer Officer
Makthaverskan - Asleep
Schonwald - Shatter
Chelsea Wolfe - House Of Metal
Still Corners - Don't Fall In Love
Tamaryn - Violet's In A Pool
Low Sea - Berlin
Saigon Blue Rain - Fading Fantasies
Piano Magic - Incurable
Class Actress - Let Me Take You Out
Frankie Rose - Night Swim
HTRK - Body Double
Ashrae Fax - CHKN

Post Punk Affiliated

Post Punk Affiliated - The Sirens

Post Punk Affiliated - Volume 29: The Sirens

ROSE HIP XXX ~ I NEED SOME LOVE (ROUGH)

Some of my favorite Post Punk Affiliated music from recent years. Volume 56

You can check out the other incarnations of these playlists by checking out these links:

Spotify: goo.gl/XA7g6W
YouTube: goo.gl/xxLwgN
8Tracks: goo.gl/7XBc6b
LastFM: goo.gl/qjseiy
Mixcloud: goo.gl/u69OrZ

Photo by @rachel-escoto

Detachments - The Morning Light
Dog Bite - Would Be
Lebanon Hanover - Stahlwerk
The KVB - Human
Agent Side Grinder - Giants Fall
Drab Majesty - Hallow
HTRK - Poison
Kontravoid - Silent Visions (Skeleton Hands remix)
Mount Sims - No Yellow Lines
Moving Units - Until She Says
In Death It Ends - Silence
Wicked Crafts - Euphoria
Be The Wolfe - Ghost On The Sun
The Mayfair Set - Dark House
Messer Chups - Dead Down Comedy
Voight - Shadow

Post Punk Affiliated - Volume 56

Taken from 'Drama' Single by HTRK, out July 6, 2018.

Order 'Drama' at: ghostly.com/products/drama
Or at the retailer of your choice: Ghostly.lnk.to/htrk-drama

Drama

HTRK - More to Enjoy

Paralelo 3 - #286 Ombra International + Mix Uxuka - 15/05/20

http://tiny.cc/5bwdpz

Niño - El último digito de Pi
Downliners Sekt - u gumbu
Cauto - Capaç
URPUR - Untitled (forthcoming)
Ilia Mayer - E S T A L A C T I T A  (forthcoming)
Dj Commodities - Videodrome (unreleased)
Ilia Mayer - A I Z Z Z K I N G (forthcoming)
Burial - Untitled
ULLA - Smile
HTRK - Pressed In Glass I
Burial - Untitled
Soundbwoy Killah - Tom loves to rave
Nazar - UN Sanctions
Al Wootton - Omega
Shackleton - Hamas rules

PARALELO 3 - Uxuka Mix - 15/05/20

FIRST 30MINS - PESSIMIST
SECOND 30MINS - HTRK
23/06/20

Pessimist And That w/ HTRK - Noods Radio - EPISODE 5

HTRK is an Australian duo of Jonnine Standish and Nigel Yang. @htrk
Artwork: Renee Jaeger

 ••• https://yourcomicbookfantasy.com/ •••

Tracklist:
Kinlaw - Rake (loop)
LST - thurspite
Kinlaw - Rake
Zebrablood - Whatcomesup96
DJ Trystero -  賛辞
Abu Ama - Sleep Well in Jakarta
Levl - Arcola_#1
Cryptobitch - Double-Flux Honeytrap
Joy Orbison - Y She’s Away (feat. Mansur Brown)
Buttechno - 808 mod cutz
Bookworms - Graffiti Pits
DJ Rashad - I’m Too Hi (feat. Earl)

ÂUGHT mix - HTRK [Nigel]

Kristian Jabs - operating under various alias' and group's:
Pessimist
Soft Boi
Stigma
1/3 Ruffhouse
1/2 Boreal Massif


For all info of upcoming gigs and for regular music related announcements, you can follow me on instagram @pessimistmusic

To book Pessimist please contact Disconnect Agency:
mark@disconnect.li

FWD.DJ - House, Techno, Leftfield, Downtempo 

FWD.DJ is a carefully curated online hub for exclusive sets and interviews from top quality underground electronic musicians.

FWD.DJ is committed to sorting through the seemingly endless stream of electronic music and holding aloft the gems. Originally launched in 2007 with a hiatus from 2012-2017. 

ben@fwd.dj

www.fwd.dj

Seltzer suppository 101 for water signs exclusively


rosehipxxx.bandcamp.com

DVS NME is an Electro music producer/deejay and Post Punk enthusiast living in Colorado. He runs a weekly mix series called @DarkScienceElectro and is actively producing under the name @DVSNME

His musical influences include, but are not limited to: Abstract Thought, Adult., The Advent, Aether Pilot, Afrika Bambaataa, Aphex Twin, Aloka, Andrea Parker, Animistic Beliefs, Annie Hall, Anthony Rother, Armec, Arpanet, AS1, Ashtar Lavanda, Audiogenetics, Autechre, Automat, AUX88, Bass Junkie, Binary Digit, Blackploid, Blatromen, Blotnik Brothers, Boards Of Canda, Boris Divider, Carl Finlow, CEM3340, Cignol, Client_03, Commuter, Composite Profuse, Comtron, The Consumer, CPU, Cyan85, Cybotron, Cygnus, Cylob, CYRK, Dark Vektor, Das Muster, Datawave, Datassette, Deemphasis, Delayscape, Der Zyklus, Detroit's Filthiest, Dez Williams, DJ Stingray, Dave Clarke, Helena Hauff, Dibu-Z, Digitizer, Ditone, DJ Di'jital, DJ Godfather, DJ Overdose, Djedjotronic, DMX Krew, Dopplereffekt, Drexciya, E.R.P., Dynarec, Ectomorph, Egyptian Lover, Ekman, Elecktroids, Electronome, The Exaltics, Heinrich Mueller, Exzakt, Fabrice Lig, Faceless Mind, FAH, Fleck ESC, Fotoapparat, FPU, Franck Kartell, Francois Dillinger, Galaxian, Gedanenexperiment, Gesloten Cirkel, Glass Domain, Go Nuclear, Gosub, The Hacker, Hadamard, Hardfloor, Headnoaks, Heinrich Dressel, Heurisitc Audio, The Hidden Persuader, I-F, Illektrolab, Imatran Voima, Inkamera, Isolated Material, Ivna Ji, IXRQ, Japanese Telecom, Jauzas The Shining, Jeremiah R., John Carpenter, John Selway, Kalson, Kan3da, Keith Tucker, Kobol Electronics, Komarken Electronics, Kon001, Konerytmi, Koova, Kraftwerk, Kronos Device, Krypton 81, Lake Haze, Lectromagnetique, Legowelt, Lithium Flux, London Modular Alliance, Low Tape, Lowfish, Luke Eargoggle, Luxus Varta, Luke Vibert, Luz1e, Machino, Maelstrom, Manasyt, Mandroid, MAS 2008, Maschine Brennt, Melogik, Mesak, MetaComplex, Microlith, Microthol, Miss Kittin, MNLTH, Model 500, Mono Junk, Morphology, Mr. Velcro Fastener, MSRG, Mumm, MystesSystem, N-Ter, Nebenprodukt, Newcleus, Nite Fleit, Noamm, Noise&Noise, Nomenklatur, NRSB-11. Nullptr, Oberman, Ole Micc Odd, Orgue Electronique, Pametex,  Paul Blackford, Pip Williams, Planet Pluto, Plant43, Polytron, Privacy, Q-Chip, R325, RA-X, Radioactive Man, Rebustape, Reedale Rise, Relaxant, Reptant, Retax Gorgon, Richard Easel, Robodrum, Rutherford, S>>D, Sansibar, Sbassship, SC-164, Scape One, Siak, Silicon Scally, Simulant, Skinny Puppy, Solar Chrome, Solvent, Solid Blake, Sonar Base, Sound Synthesis, Stingray313, Sync 24, Synth Alien, Syrte, T/Error, TecRoc, Terens K., Teslasonic, Thomas Kress, Textasy, Ticco Ross, Transparent Sound, UHU, Ultradyne, Umwelt, Underground Resistance, Unit Black Flight, Univac, VC-118A, VCS2600, Velocs, Versalife, Vertical67, Vessel In Distress, VLR, Voice Stealer, Volfram, Volsoc, Wee DJs, Weltwirtschaft, Will Web, Wumpscut, Xerodefx, XY0815, Zerkalo, Zeta Reticula, Zobol, Zwischenwelt, 96 Back, 240 Interceptor, and many more.

Disboot is a music label from Barcelona, which from 2008 has been a cradle for both new local talents such as Downliners Sekt, Cauto, Sunny Graves, Mans O and Niño as well as international names such as Offshore, Filastine and Suckafish P. Jones. Committed to taking risks and dedicated to musical innovation, Disboot is synonymous with quality electronic music that goes far beyond styles and trends.

*Disboot* es un sello del barrio de Poble Nou de Barcelona, que desde el 2008 ha sido cuna de nuevos talentos locales como Downliners Sekt, Cauto, Sunny Graves, Mans O y Niño, así como de nombres internacionales como Offshore, Filastine o Suckafish P Jones. Comprometido con el riesgo y la innovación musical, *Disboot* es sinónimo de calidad, más allá de estilos y tendencias.

ÂUGHT Magazine is a platform for seeking and manifesting the talented and masterly magicians of modern culture.

Community Radio Show
3MDR 97.1FM or 3mdr.com 
Thurs 9pm - 10pm (AEDT)
See website link to listen back, for track names & show details

Jakey Mizrahi

Booking: info@culttrax.com  
', Shop at https://CultTrax.com 

G.E.T.O dj'z inc 
The Iconic House of Mizrahi

delayed | on board music | afin | huinali 

aka Moon Patrol w/ https://soundcloud.com/irina-kotik
founder of Delayed https://soundcloud.com/itsdelayed
resident at Radio D59B https://soundcloud.com/radiod59b
one part of Alan Ford https://soundcloud.com/alanfordmusic

https://linktr.ee/gilleswasserman

New tracks tagged #htrk