Name: Summer Solstice 2020 Celebration Set | Essential Mix by 🎚 𝐓𝐔𝐍𝐃𝐑𝐀 🎛 (Patronus Records)
Duration: 1 h

Exciting and charming development, fully entertaining all along. Love the lively textures, touching deep inside my brain !!

This really takes you out for a ride...I mean Everywhere!!!

i enjoyed the ambience and the sound variations of this set very much!

Psychedelic Domain RULED! Sonic OCTANE is BURNING REEL Sci-Fi BRIGHT...OH WOW! I'm eating this up....Into the dark & fierce mysteries of the night...The sonic texturing is BAR NONE!!! I can feel the spirits of the night calling...Enthralling sonic presence! Rocketing captivation! ;) LEVELED ALL the way UP!>>

Outstanding production!!!!!!!!! HAIL TUNDRA!  I'm one-third of the way through the track & it's so day-yum FANTASTIC! ++Flew off the charts! >>> 💋💋💋❣💎🔥🔥🔥🔝🔁♾💘

as always; this is a stunning mix to fall in trance to! Love it!

D!gg!n down deep ln your stack, and what a cool jewel l found down here:)):)

( A-TRIP DJ SET ).frequency that vibrates in harmony
facebook : @MendeleDJ / Mendele de klauzel

Borking : Saturno Collective 
Borking: Tolicalien Collective

A-Trip

Apollo 22

I'd like to take this occasion to express how grateful I am for your support of my mixes and the wildly talented artists that I have had the privilege of showcasing here in my DJ sets over the years. And I sincerely hope that this next chapter in our lives that unfolds in the dawning of this new year will usher in an awakening of creativity for each and everyone of us, and will illuminate a path that leads to an inspiration of hope anew. Happy New Year party people! 

Cover art mask design by Dan Schaub
https://danschaubdesigns.com/
Cover art photography by Jasna Boudard 
https://www.jasna-boudard.com/

Mixing decks used to perform this set: Pioneer XDJ-XZ.
https://www.pioneerdj.com/en-us/product/all-in-one-system/xdj-xz/black/overview/

1. Hypnocoustics, Colin OOOD - Hocus Pocus Dance (Original Mix)
2. Psychobass - Welcome Aboard (Original Mix)
3. GiGi & Convert-X - World Party (Original Mix)
4. S.U.N. Project - Metalic Taste (Atomic Pulse Remix)
5. Volcano on Mars - World of Images (Outsiders Remix)
6. Virtual Light, BenSolo - Badgeridoo (Original Mix)
7. Mad Maxx & Tron - Experimental (Original Mix)
8. Spinal Fusion & Starlab (IN) feat. Kamya - The Great Awakening (Spectra Sonics Remix)
9. Ingrained Instincts - True To The Game (Original Mix)
10. Alienatic - They Are Our Ancestors (Original Mix)
11. Shivatree & Spectra Sonics - Objective Reality (Original Mix)
12. Tristan & Astrix - Awake the Snake (Volcano on Mars Remix)
13. Zeridium & Formantz - Monkey Poetry (Original Mix)
14. Alter Vu - Mandala (Original Mix) 
15. Tristan - Indiginous (Original Mix)
16. Tron & Mirok - Asteroid Belter (Original Mix)
17. Hypnocoustics & Mandala (UK) - Howling Totem (Original Mix)
18. Mekkanikka - Just A Machine (Original Mix)
19. Klipsun & 3LMT - The Art of Magic (Original Mix)
20. D_Maniac - Thörä Stära (Remix)
21. Inside Mind & Acid Sonic - Control Technology (Original Mix)
22. Nukleall - The Elegant Wolfman (Original Mix) 
23. Avalon & Mad Maxx - Hall of Fame (Original Mix)
24. Hypatia - Deep Feeling (Original Mix) 
25. Mergel - Mayan Tribe on Acid (Original Mix)
26. Mental Projection & Browkan - Am I Weird (Original Mix)
27. ManMadeMan - Ooze (Earthspace Remix) 
28. Astral Projection - Into The Void (Original Mix)
29. Space Cat & Kido - Kreak, Pt. II (Outsiders Remix)
30. Spirit Architect - South Wind (Original Mix)
31. Mekkanikka & Ajja - Into The Nucleus (Original Mix)
32. Bamboo Forest - Breath  (Volcano on Mars Remix)
33. Zarma & Lyktum - The Jungle (Original Mix)
34. Cymatic - Divine Contact (Original Mix)
35. Menog - Beaches of Goa (Original Mix)

New Years Eve 2023 | Psychedelic Celebration Set | 145-146 BPM (3 Hour Mix)

I Miss Koh Phangan Deep Psychedelic Mix

Below is an insightful article on an organization looking to bring about meaningful change as it pertains to our legal system here in the U.S. and how it perceives certain natural psychedelic drugs:

"Psychedelics are represented in the media, on the stock market, and in academic journals, but there’s a tie-dye elephant in the room: they’re still illegal. An organization that believes every human should have the right to use psychedelics wants to change that."

"The Mind Army(https://mindarmy.org) is a non-profit organization working to move the needle on the legalization of psychedelics with lobbying, social pressure, and celebrity influence. With the mission of “fighting for the right to pursue happiness,” it is currently petitioning the Drug Enforcement Agency to deschedule ibogaine, a powerful alkaloid that has been shown to help interrupt addiction. The Mind Army believes it has been incorrectly scheduled because the plant-derived psychedelic has been proven to be non-addictive."

"At this critical moment – in the middle of a suicide, addiction, anxiety, and depression (SAAD) epidemic – we don’t have time to wait before the most healing substances on the planet become available to the masses. Right now, when the human race needs healing more than ever, we’re demanding that people be allowed to legally access safe and effective psychedelic medicines that interrupt negative thought patterns and addictions. Mind Army has assembled the top legal experts in drug policy and reform to create immediate access for researchers and patients."
You can read more of the article here: https://www.forbes.com/sites/amandasiebert/2022/07/01/inside-vision-treks-the-mind-armys-psychedelic-retreat-takes-strangers-into-the-desert/?sh=7a9a2ec82153

Cover art entitled Psychedelic Skull by Sint3tico
https://artstn.co/m/9eV6y

Mixing decks used to perform this set: Pioneer XDJ-XZ.
https://www.pioneerdj.com/en-us/product/all-in-one-system/xdj-xz/black/overview/

All tracks purchased from www.beatport.com, www.bandcamp.com, or provided directly by the artist or label.

Setlist:
1. Oxyflux, Radikal Moodz - Fancy Footwork (Juggerknot Remix) 
2. Inpsyde Out - Druid's Drop (Warp Engine Remix)
3. Mascalito & Braingineers - Mascal In The Brain (Original Mix)
4. Shadow Shaman - Jan Shmuts (Original Mix)
5. Fantazma - Wild Tales (Original Mix) 
6. Shred'er & Xipe Totecs - Morning Pétanque (Original Mix)
7. Render, Zeridium - Riot in a Teacup (Original Mix) 
8. Huracan - Dark Matter (Original Mix) 
9. Z3nbugs - Primal Instinct (Original Mix) 
10. Siloka, Wubba Lubba - Fortune Cookies (Original Mix)
11. Radikal Moodz, Gandhabba - Rebel System (Original Mix)
12. Rugrats - Reality Check (Original Mix)
13. Ninesense, Hydra-E - Fight the Powder (Original Mix)
14. Cronyx - WoBedelic (Original Mix)
15. Mutaliens - BooBoo Lala-Land (Inpsyde Out Remix)
16. Nukleall, Adrenaline Rush - Hallucination (Original Mix)
17. Rugrats - Zone Approach (Original Mix)

The Mind Army | 148 BPM

Artist: Plasma Force. 
Single: Geimsveppir. 
Genre: Psytrance. 

Bandcamp; https://mathematicianrecords.bandcamp.com/album/geimsveppir 
YouTube; https://www.youtube.com/playlist?list=PLWX76gRjsgEwzB6Sz_oAHUs0iNycawf0d 
Spotify; https://open.spotify.com/album/18daQt1CfP9wqQIKACisaP?si=PfgDfQpPRjGuqUD2zKNMMQ  

Cover art by Seth Priske & Stewart Emery
Mastered at Mathematician Records studio A

01 Geimsveppir 

Released August 28th, 2023.​

Geimsveppir was produced by Plasma Force.
© Mathematician Records 2023. All rights reserved.

Plasma Force - Geimsveppir | Single (2023)

This is my dj set that I played for Infected Crew at night time. 
I enjoyed my self thanks to the people that was there and connect with me and the music thought out the set!

Mbizz - Infected Gathering Dj Set 10/02/24

Free Download

Memetech - Esper

maailma on kaunis ja taivas on sininen

suomisaundi is good also  for a simple  walk out

I like Finnish language

1  
"kaksitariffikolmivaihevaihtovirtakilowattituntimittari"

2
"Nordöstersjökustartilleriflygspaningssimulatoranläggningsmaterielunderhållsuppföljningssystemdiskussionsinläggsförberedelsearbeten"

3
kyyhkyslakkahillotaatelipalmusunnuntaikävelykatujuhla- koristehedelmäkaramellimassatuotevalvontalaitteisto- testauslaboratoriokäyttökertatulitikkuviinapiilohomo- kaasulasersädehoitokotikaljakimblemestaruussarjakuva- ristikkokilpajuoksuhiekka-aavikkoluonto-ohjelmauusinta- vaalikokousedustusmeno-paluuruuhkabussivuoropysäköinti- sakkolihakoukkuselkänahkavyöruusukasvimaamunajuustomaito- rasvaimunestepinta-alahuulipunakampelaverkkomahalasku- harjoitustyöaamukampapellavaöljykriisiapukeinolonkkalepo- lomarusketusrajatietoteollisuuskiinteistömarkkinointi- diplomi-insinööriopiskelijaperinnemaisema-arkkitehti- kilta-aktiivihiiliteräsbetonivalurautaristisiitoshärkä- pizzamaustevoipaperiroskapostimerkkisavusaunavastaprotesti- marssivapautusliikevaihtoväliarvojoukkopakomatkaopas- koirakantakorttitaikatalvisotakunniajäsenetupuolikuiva- rehuvilja-aittakorpisuomaastohiihtoputkitiivistesilikoni- rintataskuvaraslähtöliukumiinakenttäkeitinvesihanasaari- ryhmätyömyyrävuosikurssikirjapainopistetulotukivarsikenkä- kauppaopistoupseerikerhohuonepalveluammattikoulupoika- tyttöenergiatalousaluelaajennustarvehierarkiakaavio- suunnittelupäätöspäivävientisulkuporttiteoriapohjakunto- urheiluruutuässäpariluistelutyylituomaripelimies- voimisteluvideokulmakarvakuonokoppalakkipäämääräalennus- tilataksimittarimatopurkkikeittoastiakaappipakastin- yhdistelmälukkoseppähenkilötunnussanaleikkikalupakkipussi- eläinkoeponnistuslautakuntalakitekstiseikkailuleiri- telttakangaspuujalkasienipiirakkareseptivihkopakkaus- muovikuularuiskumaalaustarvikevarastohyllymetrilakuavain- naulakkovartiopäällikkötasogeometriavirhevaihtosähkökazoo- pillihousupukupellehyppylankakeräkaaliaivovuotosuoja- vaatekappalemyyntitykkilavatanssiaskelmoottoripyörä- koppisiemenperunapalstajakoviivaintegraalioperaattori- algebraoppilaitoskompleksilukusuoraveto-oikeusmurha- asevarikkopilttuu.


ciao ciao

Suomisaundi Is Good For Sport

If you enjoy deep bass, tribal rhythms, psychedelic atmospheres, and ascension vibes, then this may be an Essential Mix for your summer listening.
A massive thank you 🙏 for all of your continued support, and for listening.
And as always, a deep gratitude for all of the immensely talented artists showcased here in my DJ mix.

All tracks purchased from www.beatport.com or provided directly by the artist/label.

Mixing decks used to perform this set was the Pioneer XDJ-XZ.

Setlist:

1. Liquid Soul, Solar Kid, Zyce - We Come In Peace (Talpa Remix)
TesseracTstudio
www.beatport.com/track/we-come-in…pa-remix/7675812

2. Ritmo, Sphera - It's Your Time (Original mix)
Iboga Records
www.beatport.com/track/its-your-t…nal-mix/13662130

3. Domestic, Freedom Fighters, Sphera - One Level Down (Original Mix)
Iboga Records
www.beatport.com/track/one-level-…nal-mix/13186124

4. 3 Of Life, Poli - Flanger Danger (Original Mix)
Stereo Society
www.beatport.com/search?q=3+Of+Li…er+(Original+Mix)

5. Lish, Mr.What - In a Dream (Egorythmia Remix)
Iboga Records
www.beatport.com/track/in-a-dream…a-remix/12094239

6. Pondora, Ranji - Keleno (Original Mix)
Blue Tunes Records
www.beatport.com/search?q=Pondora…no+(Original+Mix)

7. One Function - Ajna (IKØN Remix)
Iono Music
www.beatport.com/track/ajna-ik-n-remix/13332312

8. Save The Robot - Artificial Intelligence (Original Mix)
United Beats Records
www.beatport.com/track/artificial…nal-mix/13543860

9. No Comment & Alegro - Control Machine (Original Mix)
Pink Revolver / Blue Tunes Records
www.beatport.com/track/control-ma…nal-mix/13096960

10. Ital, Lyktum - Elevacion (Original Mix)
Quadrophon / Yellow Sunshine Explosion / Iono Music
www.beatport.com/search?q=Ital%2C…on+(Original+Mix)

11. Lifeforms - Delusions (Original mix)
Pink Revolver / Blue Tunes Records
www.beatport.com/track/delusions-…nal-mix/13279862

12. Ectima - Annihilation (Original Mix)
TesseracTstudio
www.beatport.com/track/annihilati…nal-mix/13267689

13. Off Limits - Temple of the Sun (Original mix)
Pink Revolver / Iboga Records
www.beatport.com/track/temple-of-…nal-mix/13332212

14. I Awake - Alternative Nature (Original Mix)
Merkaba Music
www.beatport.com/track/alternativ…inal-mix/9433853

Summer Solstice 2020 Celebration Set | Essential Mix

Shea - TM clip

If you enjoy my DJ mixes, please check out the set lists and support the artists & labels that make this all possible. Music can be a sonic portal into another dimension. Feel free to step through and experience the journey.

Summer Solstice 2020 Celebration Set | Essential Mix

🎚 𝐓𝐔𝐍𝐃𝐑𝐀 🎛 (Patronus Records)

Recent comments

STONERJAZZ

N.o.b.S.

ElectroTrek

ElectroTrek

Related tracks